SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017T5E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017T5E0
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000146
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.022
Further Details:      
 
Weak hits

Sequence:  A0A017T5E0
Domain Number - Region: 144-251
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000201
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017T5E0
Sequence length 284
Comment (tr|A0A017T5E0|A0A017T5E0_9DELT) Uncharacterized protein {ECO:0000313|EMBL:EYF04449.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_4417 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MTNAIHANSSLRITKINQAGSWRKGTALKPKDGFEIDIDLIVYLDVAEATRSDVSTLHGI
IVGLLRDVYGSKASDDFKESKKTVGIEFRTSGLKVDLVPVIPVQSPADYVWQPEVGGGGS
FLTSPTKQLGFVLALKDRDPRYTSVVRLLKRWRNMAELRDELSSFTLELICAHIVGTQGP
PPRIEEGLLRVLTYIATTELKQPVSFADAIRSCPSTASPVRIFDPTNNENNVTSRLGEQE
RRTIVARAADALETLNYARTVDAKGTTMECWKEVFGPSFRIEEV
Download sequence
Identical sequences A0A017T5E0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]