SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017T6P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017T6P3
Domain Number 1 Region: 15-140
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000419
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017T6P3
Sequence length 352
Comment (tr|A0A017T6P3|A0A017T6P3_9DELT) Uncharacterized protein {ECO:0000313|EMBL:EYF04894.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_3705 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MALPSSLSVLGPSAPVAPATLDALERALGYRLPRAYRDLLCHHGAGRLLGEFWLAAPEPA
EFAHADLAERVAGWNPEARTASPIEDIPFEEWKRLIVFAARDRLELAFLKGDEDGPLWVV
HEEFGRAVRFDSFEALVRDRARLDDAVPPAEGCRWDFPASYVTDNLDLDTQLDHALSDDS
ALSDDHDPVNAVLDTLLERASGYAVWSHAFESWVRAAGTHRDAPDFRAGGERIVRNYRER
LPGLWERHHAAEGVALLRAGLTPATIATLVLHPDLAFLNARLTVGEQGDFTYASITTDTP
IPETVAISAEDASGNQGPWRHKFEPSGEEPASMFVPFGPFIPRRVRIAPADA
Download sequence
Identical sequences A0A017T6P3
WP_044243099.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]