SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017T7U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A017T7U2
Domain Number - Region: 47-91
Classification Level Classification E-value
Superfamily TPR-like 0.00986
Family Tetratricopeptide repeat (TPR) 0.078
Further Details:      
 
Domain Number - Region: 139-197
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0494
Family Regulator of G-protein signaling, RGS 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A017T7U2
Sequence length 343
Comment (tr|A0A017T7U2|A0A017T7U2_9DELT) Uncharacterized protein {ECO:0000313|EMBL:EYF04646.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_4322 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MIADPGGGAASTRRAQAAPRLVRRILASALVTLALVAPRAARADDIQMFELAKTRFDTGH
YEEAAKRFATLLDANAPPCGMGPSDPATTCRLTDVDLIERARAFSVVLLVALGRPAEADL
MIEQILLANPAYVPNPATFQPEIIDRFIAMRARTRAQIEENVRNEAEKLRRKRLAAERFR
QDELRWIGEIQRLASEERVVEHRSRWVAAMPFGVGQFYNGDTSLGWTLLISQAAAGVAAI
TSAFVVAGYEGVDVTSPPTASGEASVDIDQLNAQIQTATTVNRIAFGSWAALAIAGIVHA
QATFVPERTSVRKRKAPLPPRPTLTPSVSAGPGSLGLGLSGTF
Download sequence
Identical sequences A0A017T7U2
WP_044243849.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]