SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017TGX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017TGX2
Domain Number 1 Region: 24-77,116-186
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000118
Family SMI1/KNR4-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017TGX2
Sequence length 316
Comment (tr|A0A017TGX2|A0A017TGX2_9DELT) MoeA domain protein, domain I and II {ECO:0000313|EMBL:EYF08035.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_7057 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MREGGAMGAVKDGSTGGEAIEATWARIERWLGQRAPEVLASLLPGVGEEGLGRIEREIGA
SLPEDLRASLKRHAGSTRALSGEWELHPPAMILGTWTMMRGFAEDGVFPHGELTPGSVVG
PLVPTWWTRGWIPVAGNGAGDHLCVDLSPAEGGTRGQVLRYLHDHEHREVIATGFGAWLG
ALANGLEQGTIVAIEDPQGHLEGLYPPERLENLREEGVDTEGWAIRPRQEEEVAPAVSAV
DEEGARLIDLLLQKELLVLAEPADREALAAGLGKLLARRGSAEKKAAAVCAWMEKQAGIE
EIFVTDEELAALLDAW
Download sequence
Identical sequences A0A017TGX2
WP_081864592.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]