SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017TGX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017TGX5
Domain Number 1 Region: 4-181
Classification Level Classification E-value
Superfamily EF-hand 1.26e-28
Family Calmodulin-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A017TGX5
Sequence length 187
Comment (tr|A0A017TGX5|A0A017TGX5_9DELT) Calcium binding protein {ECO:0000313|EMBL:EYF08177.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_5937 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MTKMTEFLERRLARRFRTYDDDRNGFLERGDFEASAARMAEEFGHGPESPARQKLVALGL
GLWEHLVKVADKDADGRIGLAEYKAAFAAGLLETPESFEQGYVPFLDAIMEIVDQDHDGK
LTVTDEIRWTKAMMHLPEHDARETFRRIDKDGDGFITVSDLLEAIRGYYFDESPDSPGHW
LLGPLDS
Download sequence
Identical sequences A0A017TGX5
WP_044236127.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]