SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A021X510 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A021X510
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily WGR domain-like 9.81e-20
Family WGR domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A021X510
Sequence length 75
Comment (tr|A0A021X510|A0A021X510_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:EYR79532.1} KW=Complete proteome OX=1410620 OS=Shinella sp. DD12. GN=SHLA_81c000230 OC=Rhizobiaceae; Shinella.
Sequence
MTPRVYLTRTDASRNMARYYLMSVQATLFGEWSLVREWGRIGRAGQVRNSTYTGQAEAEQ
AMEKLRAAKVRKGYH
Download sequence
Identical sequences A0A021X510
WP_024271161.1.59599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]