SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022IRE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A022IRE7
Domain Number - Region: 33-103
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0139
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022IRE7
Sequence length 123
Comment (tr|A0A022IRE7|A0A022IRE7_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EYT22536.1} KW=Complete proteome OX=1310800 OS=Acinetobacter sp. 1000160. GN=J699_00898 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MIDKNIEFNIYKTVDFFLKCINEKDKNSLLSEFEVTLKMYQELENTLNNYFDGDYKLSLI
PFDEIHLQEVENMPIFELDEMDDGEYILECEVYNYEKDTSLILQGNVDLTNGNVHFFDPL
FKS
Download sequence
Identical sequences A0A009KSH4 A0A022IRE7
WP_032866485.1.55814 WP_032866485.1.86756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]