SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022LF58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022LF58
Domain Number 1 Region: 132-253
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 8.5e-27
Family L,D-transpeptidase catalytic domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 98-134
Classification Level Classification E-value
Superfamily SH3-domain 0.0000761
Family SH3-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022LF58
Sequence length 254
Comment (tr|A0A022LF58|A0A022LF58_9MICO) Uncharacterized protein {ECO:0000313|EMBL:EYT62535.1} KW=Complete proteome; Reference proteome OX=1292022 OS=Curtobacterium flaccumfaciens UCD-AKU. GN=H489_0113280 OC=Curtobacterium.
Sequence
MIAAAVAVVCAGAVAFVAFGPLSAAPAPTPTRSAAAPTPTPTTPKPTRSAAPVDGIDAPT
STTVAAATGASVPVSASAGGKATQTLENPQASGAPLVLRVVDQQDGWAEVQLAQRPNGST
GWVPTSAVTLSEDPYAIVVTRSTNTLDLYKAGKVVDSYPVATGTGGTPSPTGRFALTELL
APTNEGYGPYAYGTTAFSDVLNSFGGGPGQIGLHGTEDTSSIGTAASHGCIRMHNADITA
LAERLPLGTPFQVR
Download sequence
Identical sequences A0A022LF58
WP_017886479.1.36067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]