SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022LK79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A022LK79
Domain Number - Region: 31-98
Classification Level Classification E-value
Superfamily ImpE-like 0.0017
Family ImpE-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022LK79
Sequence length 116
Comment (tr|A0A022LK79|A0A022LK79_9MICO) Uncharacterized protein {ECO:0000313|EMBL:EYT64011.1} KW=Complete proteome; Reference proteome OX=1292022 OS=Curtobacterium flaccumfaciens UCD-AKU. GN=H489_0109945 OC=Curtobacterium.
Sequence
MRSRRGARKGRPRNQDNPIDVLLEQDDTTPPASAPADVDHVLGRSIEVLHSFWVQPADLV
PCDVAGCTDPAEPEAWEPVDLDTGDELPGRFCDEHQLAWITRPRETTSTTGDLVSP
Download sequence
Identical sequences A0A022LK79
WP_017885619.1.36067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]