SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022LL19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A022LL19
Domain Number - Region: 16-79
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0418
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 
Domain Number - Region: 68-105
Classification Level Classification E-value
Superfamily PH domain-like 0.0799
Family BPHL domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022LL19
Sequence length 182
Comment (tr|A0A022LL19|A0A022LL19_9MICO) Uncharacterized protein {ECO:0000313|EMBL:EYT64291.1} KW=Complete proteome; Reference proteome OX=1292022 OS=Curtobacterium flaccumfaciens UCD-AKU. GN=H489_0109130 OC=Curtobacterium.
Sequence
MTAEPPPERVVARLRPHARRLVRPAVFVVLVTAAGGFGFGVFQAQLAWLNAVVALVVLVL
VVFGGAVPLFRWMSERYVVTTRRLVVVGGLGTRTRRELLHSRGYDVTVRRRGLQGLFRSG
DVLVFPGDDPAVVLADVPHADLVVAVLHDLVEAYEARRRHREPDWDEIVGGPDRPPWGDV
RA
Download sequence
Identical sequences A0A022LL19 A0A0Q5K363
WP_017888763.1.84383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]