SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022LMX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022LMX1
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.64e-31
Family Ribosomal L27 protein 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022LMX1
Sequence length 83
Comment (tr|A0A022LMX1|A0A022LMX1_9MICO) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome; Reference proteome OX=1292022 OS=Curtobacterium flaccumfaciens UCD-AKU. GN=H489_0110635 OC=Curtobacterium.
Sequence
MAHKKGASSTRNGRDSNAQRLGVKRFGGEVVNAGEIIVRQRGTHFHPGANVGRGGDDTLF
ALSSGSVEFGTKGGRKVINIVNA
Download sequence
Identical sequences A0A022LMX1 A0A0Q5KD68 A0A1S2HAZ8 A0A1S2JGQ7
WP_017885976.1.25258 WP_017885976.1.26063 WP_017885976.1.36067 WP_017885976.1.41370 WP_017885976.1.52428 WP_017885976.1.64478 WP_017885976.1.84383 WP_017885976.1.93554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]