SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022LSS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022LSS5
Domain Number 1 Region: 258-393
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 8.37e-33
Family Peptidoglycan hydrolase LytM 0.0014
Further Details:      
 
Domain Number 2 Region: 175-271
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.68e-16
Family alpha-D-mannose-specific plant lectins 0.00087
Further Details:      
 
Domain Number 3 Region: 57-142
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000641
Family alpha-D-mannose-specific plant lectins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022LSS5
Sequence length 398
Comment (tr|A0A022LSS5|A0A022LSS5_9MICO) Uncharacterized protein {ECO:0000313|EMBL:EYT66606.1} KW=Complete proteome; Reference proteome OX=1292022 OS=Curtobacterium flaccumfaciens UCD-AKU. GN=H489_0102205 OC=Curtobacterium.
Sequence
MTTTPSTVARARRLPRIAGAVMALALAAGAVVATAEPAAASAVWVGSVPAGTKILPGDQV
TSPNGQFKLIMQGDGNLVEYGIGNRVLWASNTAGNSGAIAVVRKDRALDITRNGKRLVRW
TSAGTASSTAFKVRADGTMALLAGKAVVVGWTGFQDRVASGNRILGGTVLRSDTSNTRIL
NMRTDGNLVQKVSGRVVWQSRTGGHPGAWAELQTKGNFVIWTRDASRKKVAIWSSRTSTA
GSGNLLVQVDGNVVLYGAKDTRVWSSRPVTGLAWPVNGTKITGRYGDDRGAGHVPRYHQG
TDAPVPVGTPVYGSGTGTVTRTVANDGAYGNYIVVTYGMTTVLTAHLSKIEVKQGQIVKL
GTEIAKSGNTGQSTGPHVHVETRRNGVLVDPLKNMHFR
Download sequence
Identical sequences A0A022LSS5 A0A0Q5JT75
WP_017887527.1.36067 WP_017887527.1.41370 WP_017887527.1.84383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]