SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022MBL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022MBL1
Domain Number 1 Region: 162-308
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000127
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022MBL1
Sequence length 340
Comment (tr|A0A022MBL1|A0A022MBL1_9ACTN) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:EYT79299.1} KW=Complete proteome; Reference proteome OX=1470557 OS=Streptomyces sp. Tu 6176. GN=CF54_32045 OC=Streptomyces.
Sequence
MTTGRLGLGVPPGRRGGGQGAAPPNAAYAGQVVHFPDPVRAARHPRGVRVDEHGYPDFSP
YARAAAQIADPPEGFGVDELRLTDYVSANAALAATGHELWDTVPSVATPHGWTWHHVAGG
RRLELVPVEVKALLRHHGGIATANVDQAKRGTRPLQETRPAHFGLPKSGAAVSEQQVQGV
EEDLGYRLPGAYRSFLKAAGGCAPVGTALDAELGLLVDQPFFTVREEAAVNDLVYVNKCL
RDHLTKDYLGVGFVQGGLLAVKVKGERIGSVWFCAYDDVRDVDPAWPQPERVERLLLPCG
EDFDAFLSRLAGSPPELETVANLMVDGGFAHAVPASSVGE
Download sequence
Identical sequences A0A022MBL1
WP_026252385.1.35388 WP_026252385.1.55994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]