SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022MHE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022MHE4
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily Heme oxygenase-like 8.62e-59
Family Eukaryotic type heme oxygenase 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022MHE4
Sequence length 215
Comment (tr|A0A022MHE4|A0A022MHE4_9ACTN) Heme oxygenase {ECO:0000313|EMBL:EYT80773.1} KW=Complete proteome; Reference proteome OX=1470557 OS=Streptomyces sp. Tu 6176. GN=CF54_23530 OC=Streptomyces.
Sequence
MDSFSTLLRTASHEQHVEAENSTFMSDLLGGRLDLEAYARYTEQLWFVYEALETGADRLA
ADPVAGPFARPELFRLSALERDLAHLRGAGWRAGLRALPATEAYAARVRECREQWPAGYI
AHHYTRYLGDLSGGQIIRDRAERTWGFERRGDGVRFYTFEEVANPAAFKREYRELLDGVR
ADDLEKQRIVAECKRAFALNTAVFRALGEEFPLTA
Download sequence
Identical sequences A0A022MHE4
WP_037893399.1.35388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]