SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022N7X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022N7X4
Domain Number 1 Region: 123-312
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000000216
Family YiiX-like 0.02
Further Details:      
 
Weak hits

Sequence:  A0A022N7X4
Domain Number - Region: 34-108
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0667
Family Regulator of G-protein signaling, RGS 0.016
Further Details:      
 
Domain Number - Region: 426-535
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.08
Family CAT-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022N7X4
Sequence length 640
Comment (tr|A0A022N7X4|A0A022N7X4_ENTMU) Uncharacterized protein {ECO:0000313|EMBL:EYT95704.1} KW=Complete proteome OX=1450511 OS=Enterococcus mundtii CRL35. GN=AK89_07230 OC=Enterococcus.
Sequence
MKIKLFFTTFLLIVSLQFSNMQVLAEAESYQSLEDYYEFFENEYVSIRRTFEEFSADYYN
QTPYLDEDHLKEYAHSINDTYLTEEAERLAKIPPLWSFNIGNSLDNITFEKKPEYGTYDL
LNTVQPGDVIFEVNRADILIRYLHHVMIVDDIVEETHIINGKEETFTYIRTIEATKGNFG
VKSDGVVYGVLDDERFDYTNASILRVPEATVLQKQAAVRFMESQLRKGYALHDLDDHDNH
RNRSSSRSTWYCSMLVWAAYMNATPDGNIDDLTPGDDPNFQGIDLESKDDPFESPTITPN
DIWRSDKLEKISPSFPEYNDYTKNITWAGGGSPMEGEDFIFSRNSNLYYLENDYHFLAID
QNNQRPYTNKSLTLGRNASGNVVAQLDLFTNFALTDEAKQKYADKNIPVVPNGIELADIP
NYVMNWINRYTQCSFDIVYSKDITTDSNHLRYNPTYSKIDQKAHPSYGYLVSQVVHTSPA
FTQRTFDYTENLSVYENYDLAYPNPLNYDVSYTKNRPTWYYFFNNFHALIKLENGTYRSA
TYLRFHGSFTTPASQRNGYGLNYDFTMTDEAKTIYQNYYYHIGVNQSVDYAIDWLNQYTK
EEVLIVYSTNITNDLKRLNDDTASVGKGLNDQGKWVNCII
Download sequence
Identical sequences A0A022N7X4
WP_034688934.1.59274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]