SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022PKD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A022PKD0
Domain Number - Region: 27-127
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000114
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022PKD0
Sequence length 211
Comment (tr|A0A022PKD0|A0A022PKD0_PHOLU) Uncharacterized protein {ECO:0000313|EMBL:EYU15944.1} KW=Complete proteome OX=1393736 OS=Photorhabdus luminescens BA1. GN=BA1DRAFT_01430 OC=Morganellaceae; Photorhabdus.
Sequence
MWPLTDKLLSICSHDISSVRSEKYIASNYGKSLVDELSCLLTKKNGFYGFESALRVFPYE
TIGEEIGLIEWNNNRLWINSYEDMAKDALFFAEDIFGNQFCLKDDCIHTFDPETGLFDKL
AESINEWSGIILEDYEVLTGYSLAHNWQNIYGHIQSGYRLVPKIPFVLGGEYELENLYLA
RTGESMRARADLALQIRNIPDGASIKMDIKD
Download sequence
Identical sequences A0A022PKD0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]