SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022Q0L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022Q0L7
Domain Number 1 Region: 39-89
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0000204
Family Cystatins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022Q0L7
Sequence length 140
Comment (tr|A0A022Q0L7|A0A022Q0L7_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU20045.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a0159391mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MALRLTDKLNDDEPDCDDNDFYCGHKLMYDRDTPGYFPPNLEACIPLVDLAIDSYNQQHS
KDYRVVEIVRIIAAVCSGIDLYMKFTAAASKEDGGSDAAVTFGAEVHKGITETTVEYVYV
VAEGATLPVDVLPACYNPCG
Download sequence
Identical sequences A0A022Q0L7
mgv1a015939m|PACid:17683016 XP_012858440.1.32330 XP_012858441.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]