SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022QC07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QC07
Domain Number 1 Region: 135-209
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.44e-16
Family SNARE fusion complex 0.0034
Further Details:      
 
Weak hits

Sequence:  A0A022QC07
Domain Number - Region: 10-157
Classification Level Classification E-value
Superfamily t-snare proteins 0.0314
Family t-snare proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022QC07
Sequence length 270
Comment (tr|A0A022QC07|A0A022QC07_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU26207.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a011801mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MPVQELQMNPQMEQIHGEIRDTIRALANGFQKLDKIKDSNRQSKQLEELAGKMRECKRLI
KEFDREIKDEESRNPTEVNKQLNDEKQSMIKELNSFVALRKTYISTLGNKRVELFDMGAG
ASEPTADENVQVASEMSNQELIHAGMKTMDETDQAIERSKQVVHQTIEVGTETATTLKGQ
TDQMGRIVNELDTIQFSIKKASQLVKEIGRQVATDKCIMLFLFLIVCGVVAIIVVKIVNP
NNKSIRDIPGLAPPAPTTRRLLYVKPAQYF
Download sequence
Identical sequences A0A022QC07
mgv1a011801m|PACid:17692753 mgv1a020155m|PACid:17690269 XP_012842610.1.32330 XP_012850778.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]