SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022QFS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QFS4
Domain Number 1 Region: 112-229
Classification Level Classification E-value
Superfamily NTF2-like 1.56e-24
Family SAV4671-like 0.0067
Further Details:      
 
Domain Number 2 Region: 42-116
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000314
Family F-box domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022QFS4
Sequence length 239
Comment (tr|A0A022QFS4|A0A022QFS4_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU26419.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a012807mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MLCDCTGEQSGEGDTWGKMTARVNGSVGSENSREVLVERQTGASMMEQLVPEITTHALSY
LDFPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTIEQDNLRPPNGWKAYYAATRAIVNI
NTEFFTLVKNRSLTAMSQFWLNADYVKCFHPTGESFTGYNAVMQSWQIEFGWENVVDFEI
RDVKARVMADMAWVTMNAYDIETGPHNVTNIYENHNGRWYMVHHHISPVLIHGGVQPLL
Download sequence
Identical sequences A0A022QFS4
XP_012850523.1.32330 mgv1a012807m|PACid:17670647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]