SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022QN13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QN13
Domain Number 1 Region: 139-208
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.72e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022QN13
Sequence length 260
Comment (tr|A0A022QN13|A0A022QN13_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU28673.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a012143mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MDPQGAAMMNDGGVYNFAEIWPGFQMNAAAASYGLGLDPMLVDQRSNNSPPNHNSRKRRD
EEDDCAKGGAASTSNSNGNSNNNNFMQNEVDYKRMKSVGSNGNYENKAEGEGNSGKAGEA
PVKPAEPPKQDFIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNKVIGKALV
LDEIINYIQSLQRQVEFLSMKLEAVNARVGLDGFPSKDFTQPNFDSSSMAFGSQSTREYD
RNSPPDWLHMQIGGGFERTS
Download sequence
Identical sequences A0A022QN13
mgv1a012143m|PACid:17673591 XP_012847721.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]