SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022QUU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QUU3
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 5.93e-38
Family Pollen allergen PHL P 1 N-terminal domain 0.0000728
Further Details:      
 
Domain Number 2 Region: 134-227
Classification Level Classification E-value
Superfamily PHL pollen allergen 8.63e-25
Family PHL pollen allergen 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022QUU3
Sequence length 232
Comment (tr|A0A022QUU3|A0A022QUU3_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU32432.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a018748mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
NNSFGGGFSVAVATWYGSPEGAGSGGACGFADDVANPPYNGLISAGNQNIFKHGQGCGTC
YQVKCTENPECSTYPIKVTITDECPGACNNEAFHFDLSGKAFGYLAKPGQGDALRKRGRI
NIQYERVPCSYNTGVTFKIDSGSNPNYMAFAIEFVGGDGDIGAVEMHPANSGTLYMQQSW
GATWKVGIPVGVKGPYSVKITTIESKNTIYASNVIPANWAPGQYYHSNVNLS
Download sequence
Identical sequences A0A022QUU3
mgv1a018748m|PACid:17681511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]