SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022QUV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QUV9
Domain Number 1 Region: 21-115
Classification Level Classification E-value
Superfamily L domain-like 3.74e-27
Family Polygalacturonase inhibiting protein PGIP 0.012
Further Details:      
 
Weak hits

Sequence:  A0A022QUV9
Domain Number - Region: 106-165
Classification Level Classification E-value
Superfamily ssDNA-binding transcriptional regulator domain 0.0698
Family Guide RNA binding protein gBP 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022QUV9
Sequence length 214
Comment (tr|A0A022QUV9|A0A022QUV9_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU31379.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a020154mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MVFRESATISTKGSEYQYDTTLALVTNIDLSSNNLLGDIPKELTSLVELRSLNLSGNHFT
GLIPQAIGDMKQLESLDLSRNSLSGEMPNSFRAMSTLNYLNLSYNQLTGRIPESTQLRGF
DNSSFIGNDLCGFPLTRNCSSGGPNKREDNGSDDKSSSKIEWFYVFLSLGYAAGFSIFCT
TLVLNKSWRVAYFGLVEDICNRAYYGFEQEWRLI
Download sequence
Identical sequences A0A022QUV9
mgv1a020154m|PACid:17673919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]