SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022QW64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QW64
Domain Number 1 Region: 134-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.98e-18
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.032
Further Details:      
 
Weak hits

Sequence:  A0A022QW64
Domain Number - Region: 49-59
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0165
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022QW64
Sequence length 313
Comment (tr|A0A022QW64|A0A022QW64_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU31548.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a022765mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MYILFTLDQYDQKQNQTKNSPKSAVSATTLCPSPPPLTSTTYGFLTLDPPPPPPAAPPPR
LKLGSLLSTPLSEPDPDPETINSWDLMAGLVDSDNAPSFRFSTPKPSETPNLVISDNYAS
LKSFLDGFETICPPNGGENKVVLYSTSLRGVRKTFEECNSVRSAIQGLGISVSERDISMD
RGFRDELTELMKKTTKNKNRKGAESSNVVETTPPRLFVKGRYIGGFEEVMKIVEEGYIGK
LLEGLPMIKGGYNNVCEGCGGVGFLPCFTCYGSCKMTVIINEQVNKKKKKNKSVVVKCSD
CNENGLVICPICA
Download sequence
Identical sequences A0A022QW64
mgv1a022765m|PACid:17696122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]