SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022QWD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QWD2
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000549
Family F-box domain 0.0044
Further Details:      
 
Weak hits

Sequence:  A0A022QWD2
Domain Number - Region: 91-245,308-338
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000722
Family Quinohemoprotein amine dehydrogenase B chain 0.066
Further Details:      
 
Domain Number - Region: 250-295
Classification Level Classification E-value
Superfamily NAC domain 0.0288
Family NAC domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022QWD2
Sequence length 341
Comment (tr|A0A022QWD2|A0A022QWD2_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU31638.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a019337mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MADYLPEEIVINILQRLPVETLLRCTAVRKSWYSLITSPEFISSHLKLAAAAADETPLLL
IRRRISSSERYELHSDGEPLTRVSKLNFPFSSTNSYFTIVGSCNGLLCIYDDRVDYTDTI
ILWNPCIKKSILLPEPNLIHNSYGGFAQSFGFGFDAIAGDYKVVRVSCVDDLDHQIELYK
LSTGAWQDISSHLKFDRCFIIDDRSRQAYVNGATNWIASCPHSCDFIVLFDMSTEVFGEI
KLPIEVSETDPIISKDLMVFDERLALVLCSDSAVEPTFCVWVMKEYGVEESWCKQLVFEF
HILGAIFIRPLWVRKCGRVMAVLQDGGLYSFDLNDDEIKDL
Download sequence
Identical sequences A0A022QWD2
mgv1a019337m|PACid:17678931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]