SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022QYC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QYC1
Domain Number 1 Region: 4-66,100-130
Classification Level Classification E-value
Superfamily F-box domain 0.000000000235
Family F-box domain 0.0073
Further Details:      
 
Weak hits

Sequence:  A0A022QYC1
Domain Number - Region: 92-230
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000275
Family Galactose oxidase, central domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022QYC1
Sequence length 290
Comment (tr|A0A022QYC1|A0A022QYC1_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU31545.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a024021mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MAASNIPREIIEIILSKLPSVKPLLRFKTVSKSWNTLISDLVFIQTHLHSLKTSPDNLFL
SRYKKSANSGFPMVKFEGGKVDAGVIFVENIPNSYNAILCECNGVLLLTRYDYDEYALWN
PSTRETFPINYHGEFSGSYILDYGVCYDQITADFKVVFVSLTEYEIYSCNKNSWTKKNFR
TDYYNVAGTGSGIFLDGATYWIFGEGSHTSGIQLVYFDPRTDEIKRLQKPKQLSDDDKYQ
LIRMDTFRGSLCLYCYNNQEESVQIWIKEKGIDLGYTNWKEFITVRDFKP
Download sequence
Identical sequences A0A022QYC1
mgv1a024021m|PACid:17683970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]