SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022R498 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022R498
Domain Number 1 Region: 18-154
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.36e-35
Family Poly(A) polymerase, PAP, N-terminal domain 0.021
Further Details:      
 
Domain Number 2 Region: 158-285
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.7e-34
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022R498
Sequence length 290
Comment (tr|A0A022R498|A0A022R498_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU35051.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a019566mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MSLLSRYVQKNTPCRSDVVSFNPQFLRVFESLIPAVEIRAKQEQLFTLLENLITQELPRA
RLFMYGSCANTFSLFESDIDICLHLGDNNVDKSHVLLGLADLFRIQHFKDVQAITNARVP
VLKLKDPTTGISCDICVNNMLAVVNTKLLRDYSQIDVRVQQLVLIVKYWAKSRKINEAYR
GTLSSYSYVLMCIHFLQQRWPAILPCLQRMGTTYSTTAEDIECSYFDRVKELRNFGIRNR
ENLSQLVWAFFHYWAYCHDYVNDVISVRTGDLLSKREKGWTIRVGNDRHL
Download sequence
Identical sequences A0A022R498
mgv1a019566m|PACid:17670771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]