SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022R577 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022R577
Domain Number 1 Region: 52-120
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000445
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022R577
Sequence length 233
Comment (tr|A0A022R577|A0A022R577_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU35154.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a021442mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MFRSQNDNEGVVLFNEGPSILISDEQDKILEELLADYATEVNATAEENNNVESKKSMHRD
IERQRRQEMSLLYASLRSLLPLEYVKGKRAVSDHMHQAVNYIKNMQKKIGEMRIKRDELN
KLSNNVSETREDRVIIEAANSSPTFCVKINLCINGGIFEILISSSIIDKGSFSPSKVFDK
LLQRGLNVISFVSTRVDKLFLHKIQIQENDFTSNIDLTKLEEELLPCIIGYLV
Download sequence
Identical sequences A0A022R577
mgv1a021442m|PACid:17693437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]