SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022R7P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022R7P1
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily HMG-box 0.000000301
Family HMG-box 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022R7P1
Sequence length 153
Comment (tr|A0A022R7P1|A0A022R7P1_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU36014.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a025679mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MSVDAASERVCYVHCNFCNTVLAVSVPCSSMLSNIVRVRCGHCSNLLSVNMGSLLHSLHL
QDTNFQTLMYMHASPLKRQRVPSAYNRFIKEEIQRIKASNPEMRHREAFSTAAKNWAHFP
DINNYGLKLGANKLAKLDHHADAAGGDRSTHRS
Download sequence
Identical sequences A0A022R7P1
mgv1a025679m|PACid:17690662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]