SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022RBX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022RBX3
Domain Number 1 Region: 10-114
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-36
Family Chaperone J-domain 0.00017
Further Details:      
 
Domain Number 2 Region: 270-357
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.4e-19
Family HSP40/DnaJ peptide-binding domain 0.00084
Further Details:      
 
Domain Number 3 Region: 150-222
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 7.19e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.00021
Further Details:      
 
Domain Number 4 Region: 124-158,225-268
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.35e-16
Family HSP40/DnaJ peptide-binding domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022RBX3
Sequence length 425
Comment (tr|A0A022RBX3|A0A022RBX3_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU37228.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a006942mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MFGRGPPKKSNNTKYYEILGVEKNASPDDLKKAYRKLAIKNHPDKGGDPEKFKEIAQAYE
VLNDPEKREIYDQYGEDALKEGMGGGGGGGHNPFDIFESFFGASGNPFGGGGGSRGQRRV
RRGEDVVHPLKVSLDDLYNGTSKKLSLSRNVLCPKCKGKGSKSGASMKCSGCQGAGVKVS
MRQIGPSMIQQMQHTCSDCQGSGERIADKDRCAQCKGEKVVQEKKVLEVVVEKGMQHGQK
VTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLD
NRQLLIKSESGEVIKPDQFKAINDEGMPMYQKSFMKGKLYIQFSVDFPESLNPEQSKAIG
TVLPSKSTNQLTDMELDECEETTLHDVNMEEEMRRKQHQHAQEAYDEEDDDMHGGGAQRV
QCAQQ
Download sequence
Identical sequences A0A022RBX3
XP_012837775.1.32330 mgv1a006942m|PACid:17673986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]