SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022RER3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022RER3
Domain Number 1 Region: 16-85
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000563
Family Calmodulin-like 0.065
Further Details:      
 
Weak hits

Sequence:  A0A022RER3
Domain Number - Region: 83-131
Classification Level Classification E-value
Superfamily RING/U-box 0.000671
Family ZZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022RER3
Sequence length 148
Comment (tr|A0A022RER3|A0A022RER3_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU38474.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv11b018110mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MADIHKIAKAYYARATEEEREKAKNYFRSLDANCDGKISFAEYKTMVSRRCANDTMFNAI
DKNGDGSLDIEEVLALYFILMKCPLRSCNACGSSISGAYFSYLPCEKNDPNTYELCCSCY
GGGKFEHHHLAAKKFEKVDAGIQRQKKI
Download sequence
Identical sequences A0A022RER3
mgv11b018110m|PACid:17671234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]