SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022RHV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022RHV6
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 8.42e-35
Family Ribosomal proteins L24p and L21e 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022RHV6
Sequence length 164
Comment (tr|A0A022RHV6|A0A022RHV6_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU39962.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a015236mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MPAGHGLRSRTRDLFARAFRKKGPTHLSTYLRTYKTGDYVDVKVNGSIHKGMPHKFYHGR
TGRVWNVTKRAIGVEVNKQVSNRIIRKRIHVRIEHVQPSRCHEEIRHRIIKNDQLKAEAK
AQGKIISTKRQPAGPKPGFLVGGATLETVTPIPYDVVNDLKGGY
Download sequence
Identical sequences A0A022RHV6
mgv1a015236m|PACid:17676880 XP_012834415.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]