SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022RKT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022RKT1
Domain Number 1 Region: 200-350
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.88e-59
Family Poly(A) polymerase, PAP, middle domain 0.00000632
Further Details:      
 
Domain Number 2 Region: 7-198
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.63e-46
Family Poly(A) polymerase, PAP, N-terminal domain 0.00000719
Further Details:      
 
Domain Number 3 Region: 352-466
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 2.55e-24
Family Poly(A) polymerase, PAP, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022RKT1
Sequence length 467
Comment (tr|A0A022RKT1|A0A022RKT1_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU40811.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a0210632mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MATNIDIWQPVSRSSPDKFDFLENQELEKFLAKSGVFESREASSKREEVLGRLDQIVKTW
VKNLSRAKGYSESIVDEANAKLFTFGSYRLGVHGPGADIDTLCVGPQYASRSISSADFRK
MLSEMPEVEELHPITEAYVPVMKFKFNGVSIDLLYANVSLSCIPEDLDISQDSILQNVDP
KTVRSLNGCRVTDLILRLVPNVKTFCTTLKCMRLWAKQRGIYSNVSGFLGGINLALLVAR
VCQMYPNAMPSMLVTRFFRVYDQWRWPLPVMLCPVEEKSLGFRIWDPRTNCMDKLHRMPI
ITPAYPSMNSSYNVSASTLQFMVQEFHRGNEICKAIEVSKGSCWDSLFEPFAFFEAYRNY
LQINIAAKDGVDLLNWKGWVESRIRLLTLKIERDTNGMVQCHPHPGEFSEKSKPFQHSYF
MGLQRKQQGSANPKESQLQVDLRTTVDEYINYDVYKYASWKENMSIQ
Download sequence
Identical sequences A0A022RKT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]