SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022RUV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022RUV8
Domain Number 1 Region: 12-123
Classification Level Classification E-value
Superfamily Bromodomain 6.54e-34
Family Bromodomain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022RUV8
Sequence length 156
Comment (tr|A0A022RUV8|A0A022RUV8_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU43776.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a019479mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
QEAARVTRMQEIMPPLGNILRQITQHEWAEPFMKPVDVIGLGLHDYYQVIEKPMDFSTMK
TKMEARDGTGYKNILEFCADVRLIFNNTIKYNDERDDVHIMANFLLNKFEEKWSQISPKV
DEEEKRRRDEEFEMQYHIIQLAQEAAHVKMARDLTF
Download sequence
Identical sequences A0A022RUV8
mgv1a019479m|PACid:17671095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]