SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022RXH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022RXH4
Domain Number 1 Region: 10-187
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.12e-23
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 259-343
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000301
Family Pseudo ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022RXH4
Sequence length 563
Comment (tr|A0A022RXH4|A0A022RXH4_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU43670.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a022389mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MYLLHLLFVPLHKAALKGDWEAAKELLIKDPSLVKDSLTEGGETALHISAVEGHSFFVHN
LLKLMQDSDIEILNKKGTTALCFAAAAGNLNIVKLMVHRNPDLPTIRGPDGVTPLYMAAF
LGHTHVADYLFPLSDFQSWTVEDQITLLTTTIDSQLYGLAMTIVDQWKSLAVVEDSNGET
ALQVLARKPLVFCRSSNTSQGLCGRIASAILLRYTKVRTHDIRAPCDAYTLLDCLWNIVI
CQEEDVETTRVVTKNTTKLFFIAAESGNEEFLVELIRRYPDFLYKVNESKQSIFHIAVLH
RYVQVFNLLYELRGAKDLMATYVDKDGNNMLHLAARLAPQNQLNLIPGAALQMQREVLWY
KEVEKIVQPSYRNKKNSSGKTPWELFVSEHEELMKQGEKMMKQTAKSCMLVTILIATVVF
TAAFTVPGGYDNANGTPILKNHRLFVVFPISEAVATLSSLTSMLMFLSILTSRYSGNDFL
NTLPFWMVVGVAALFVSIVAMMVAFCTCLLFYQHGFGAVTVLLVMFASVPIIFIVLKYPL
LVTILRCTYGCKALFRSNNRLLS
Download sequence
Identical sequences A0A022RXH4
mgv1a022389m|PACid:17675845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]