SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022S5M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022S5M4
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Histone-fold 2.95e-37
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022S5M4
Sequence length 135
Comment (tr|A0A022S5M4|A0A022S5M4_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU46700.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a023582mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
EQDRLLPIANVGRIMKQILPPSAKISKEAKETMQECASEFIGFVTGEASHKCHKEKRKTV
NGDDVCWALSNLGFDDYSDSLKRYLIRYRDAEGERANQNKAAGGGGGSGGGGDRDDEVDA
PPLPFSFNLMDKRRN
Download sequence
Identical sequences A0A022S5M4
mgv1a023582m|PACid:17692070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]