SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022VQV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022VQV8
Domain Number 1 Region: 181-293
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 3.66e-39
Family eIF-2-alpha, C-terminal domain 0.0000421
Further Details:      
 
Domain Number 2 Region: 90-176
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 6.8e-31
Family eIF2alpha middle domain-like 0.0000619
Further Details:      
 
Domain Number 3 Region: 10-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.06e-17
Family Cold shock DNA-binding domain-like 0.0000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022VQV8
Sequence length 305
Comment (tr|A0A022VQV8|A0A022VQV8_TRIRU) Uncharacterized protein {ECO:0000313|EMBL:EZF48334.1} KW=Complete proteome OX=1215330 OS=Trichophyton rubrum CBS 288.86. GN=H103_07980 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MSLTNCRFYEEKFPEIDSFVMVTVKQIAEMGAYVKLLEYDNIDGMILLSELSRRRIRSIQ
KLIRVGRNEVVVVLRVDKEKGYIDLSKRRVSPEDVGKCEERYNKSKSVHSIMRHVAEKTK
TPIEELYQQIGWPLNKKYGHANDAFKLSITNPAVWDDVTFPSAVVKDELISHINKRLTPP
PTKVRADIEVTCFGYDGIDAVKDALRAAEAVSPQVKVKLVAPPLYVLTNHCLDKTQGVKL
LEEAIEKVQEKIKSSGGSCVIQMAPKAVTEQDDADLQALMEKRERENQEVSGDESYSESD
EGVVE
Download sequence
Identical sequences A0A022VQV8 A0A022XFS1 F2SC00
TERG_00559T0 XP_003238568.1.23396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]