SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022VZJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022VZJ8
Domain Number 1 Region: 78-233
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.53e-18
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00043
Further Details:      
 
Domain Number 2 Region: 457-516,575-609
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000418
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022VZJ8
Sequence length 649
Comment (tr|A0A022VZJ8|A0A022VZJ8_TRIRU) Uncharacterized protein {ECO:0000313|EMBL:EZF51384.1} KW=Complete proteome OX=1215330 OS=Trichophyton rubrum CBS 288.86. GN=H103_05252 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MAVGVKQMLDGERLDSKPTPKFEIMSPAHINTSPRDADPCHGEKRAGGTRLEDSLMDGQK
GINSLGRTDTHTKRVILATSTPFADTIVRSLYRDPDVELRLIVLEGLGVGQKEMDNVECY
EDTPQRVTDTTSQTLRGQFNMTAANLADWADLLIISPMDAGTLGSMVCGLTTSLTLTLLR
GWDVSKSIILVPGMTTRQWVAPITRRHLDDIQVFWPWVKVLPPILSKFEAPDRLAELPWD
GRESFYDEIKKALGWSVGTGVDGRNTPSQEIEIPGKENGLNEKQNGMIPPSMNLQSSDSF
SSQTTITHPTPTQTALPSEILSMIFEALGDWETAAAVGIYTQLPTPDQWKPLIPRSHSSQ
CTLEYAILKRPFSEIEQYLSSASPWKPLSSLSAHLILKFSRIDILDLIITSRSDIFWSTP
RLLNLPFRASAIYGNTALLDWWLHCPELPKKDYLTDAMDSASRAGYIHVLDWWRNSGLPL
LYTERALESASAEGHISVLSWWKNASECSPAHSLPLKVGKSVILAAQSGRTNSIAWWDQS
GIPYSYTESVARIASTHGHVHVLELWYKLKGTKMIFDNQVLVGATKNGHVDVLEWWRRSG
LHVEFKTCDIEEALEDAIAGSEEKVRRWWERNGLNLGVGTSEWMKVKVL
Download sequence
Identical sequences A0A022VZJ8 F2SLX8
XP_003235937.1.23396 TERG_02991T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]