SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022W385 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022W385
Domain Number 1 Region: 126-214,279-338
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.83e-19
Family SMI1/KNR4-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022W385
Sequence length 535
Comment (tr|A0A022W385|A0A022W385_TRIRU) Uncharacterized protein {ECO:0000313|EMBL:EZF52538.1} KW=Complete proteome OX=1215330 OS=Trichophyton rubrum CBS 288.86. GN=H103_04410 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MAASFSSTWRSFWHTMTSNDRHASHDSPYRTGQHVPLSQSRDAPLTSVATSAIESRPDLT
NSFDEPPSLSRSSTSQNTITSPTRPYSPGMRSLSSQKLDQSSVDGSEIQMQSFHDGAPPP
PPVSHSWKKIDRWVEKNYEELFDQLCEGCTQNDVNELEHELDCSLPLEVRESLQVHDGQE
RGGLPTGIIFGCMLLDCEEIVQEWKNWRTVNEEFLSSSTVSHPQPPLRAYGGAAASSSSA
PPPPPAPQQNASNPLWRQELLDRQDSQPPRAIQKAYAHPAWIPLARDWGGNNIAIDLAPG
PAGKWGQVIIFGRDYDCKYVIARSWASFLATVADDLHSPHVYVDEEGGELKLKPFRQHEP
PYLEILRWRTDQKYGRRQPKRRSNGLGVNTNINGKTTRDSPYGSPTPSEDRGRSPHRFPS
RGPTGSPAGAMGVSSPLARVTEETSSPVNNNTTKNELDLKIQSKLRKSDDLVDLSSPVLQ
KPTEPFPAPETKTEISSEQATNGEAKENSPPTNDKTTPSKGLDADALDDMKTVEI
Download sequence
Identical sequences A0A022W385 A0A022XTX1 F2SQ28
TERG_04178T0 XP_003235125.1.23396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]