SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022XU47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022XU47
Domain Number 1 Region: 13-144
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.56e-35
Family Ankyrin repeat 0.0000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022XU47
Sequence length 194
Comment (tr|A0A022XU47|A0A022XU47_TRISD) Uncharacterized protein {ECO:0000313|EMBL:EZF74197.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_03904 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MIAASLKDGEGDAIVDQLLRKDADVNMKTSSGQNAIHFATSKNNISTVRKLLENKCSARV
KDKRGQLPLHRAAAIGSVPLVKLLIEEGKSPLNATDVDGLTALHHAISEGHGEAALTLLR
AGAEADKRDSNGQLAIELSPDSKVRGIHFAFDVMICVTNGCKCRYLTDFDRFGSTSLKLR
KEKALNCHDDIYYC
Download sequence
Identical sequences A0A022W4J8 A0A022XU47 A0A080WUU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]