SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022Y0D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022Y0D2
Domain Number 1 Region: 179-268
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.01e-21
Family HSP40/DnaJ peptide-binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 62-131
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 3.53e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.0000953
Further Details:      
 
Domain Number 3 Region: 37-69,135-178
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000000051
Family HSP40/DnaJ peptide-binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022Y0D2
Sequence length 330
Comment (tr|A0A022Y0D2|A0A022Y0D2_TRISD) Chaperone DnaJ {ECO:0000313|EMBL:EZF76209.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_02360 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MNAEDLFAQFFGGGGGAFGGMFGGGMRETGPKKARTIHHVHKVSLEDIYRGKVSKLALQK
SAICSQCDGRGGKEGAVKTCGPCNGTGMRTMMRQMGPMIQRFQTVCQECGGEGETIRDRD
RCKRCLGKKTVLERKVLHVHVDRGVKTGHKIDFRGEGDQMPDALPGDVQFEIEQKPHPRF
QRKDDDLFYQANIDLLTALAGGTINIEHLDERWLSVTIAPGEPITPGQIKVIPGQGMPSY
RHHDFGNLYIQFNVQFPEKDQLQNLELLEKVLPPRLTQEMPPPDSMVEDFVLENVDSNGG
QARAQGAARGDDDEDDGIPPGAERMQCASQ
Download sequence
Identical sequences A0A022W9K2 A0A022Y0D2 A0A080WHU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]