SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022Y0J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022Y0J2
Domain Number 1 Region: 13-229
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-37
Family Ankyrin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  A0A022Y0J2
Domain Number - Region: 314-384
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00115
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022Y0J2
Sequence length 428
Comment (tr|A0A022Y0J2|A0A022Y0J2_TRISD) Uncharacterized protein {ECO:0000313|EMBL:EZF76455.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_02216 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MAIELAGAGAPSQTALQLAARHGNHDEAKLLLQTGIDANFFPKGTEYPLAYAIESGDAET
VKVLLEYGADIHQAAKKHGNALIASIKRGEEEIFNIFLGKFDPNSTDRVGAPALYFAAVG
GHETMVNKLIRRGADVQACRDTIFSPIMGAGLGGCSRIVKTILQNGADSDHAALFAASSV
GEDELVTQLLLRGADVGRCILPYDRDLPIHAAMLQGHETTVRILLAAGATLISRHFPYVF
LETASRGYFRISKLILNEHLTGHIRLCLGTNPFSGRISHIPIALLLSTLKVGVRNSNASL
AWEFVEPYGQTTVDFMEYLLTQDSIQLPVDSPKSVLKSAIKHCNDTLLSFLLDSFEVNVS
GDFPNLIELAVINGSVPTLEVLLKRTTEQTESKTLRWKLYLSRALNTAVERNNFHMVELL
DRYGTFTK
Download sequence
Identical sequences A0A022WA08 A0A022Y0J2 F2SVB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]