SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022Y5J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022Y5J5
Domain Number 1 Region: 1148-1257
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.35e-20
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 408-553,617-739
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000249
Family Ankyrin repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 758-847,886-928
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000034
Family Pseudo ankyrin repeat 0.034
Further Details:      
 
Domain Number 4 Region: 158-453
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000209
Family Ankyrin repeat 0.0028
Further Details:      
 
Weak hits

Sequence:  A0A022Y5J5
Domain Number - Region: 890-1014
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00012
Family Ankyrin repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022Y5J5
Sequence length 1600
Comment (tr|A0A022Y5J5|A0A022Y5J5_TRISD) Uncharacterized protein {ECO:0000313|EMBL:EZF77878.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_01008 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MENSNDSMHSRMRLEQLAADMGVYMNMKFPRITRKDTVSSFSQHDKDAAEALAKRKRLEA
FSAKSHVFRRTPSKRSFKREELYSAIDTAIRDDASLGMLEYLLTQLKETKAKKSFFKTQE
NSVALDMTDLLRLATEKRNSSFLEILSPHVDQWGLDAALGIAVASLDLHCIKALLQNGAD
PNSCHQQFVTAVGNGHVAVVEMLAGTEKKLSSSCLDEALPVAVSIGSMRLVMCLIHNGAN
ADTDQILETAVRAGRLDISAALVLASRPPSRISLDSAAGAAYHSNNLSSEERDSLLELLL
CAGANGDCVARALVSAVAANDKPSVSLIVSYNGNVTYNSCEAIIAAIKGGNLHLHDILFK
GAIDPDSASTALSRVPEVESSLSPTKKISIIAHFIKCGAYGSPLHQCLVDAVHKNERILI
DLLIQNDASVDYDEGHALRLAISAGALPIFRKLMEGRPSRATLGHCIGLLPSLQPRLQFT
VAQDLLAAGAKGDAVNKILIGAVMSEFPAEREQLIELLVNHGANVDAQNGNCLVQAVKVG
DVVVLKLLLQGRPSSSSLSRAVVPAVSLRDRILRFSILDLLLGSKEASGLQINQELVTLL
KENPLDIVAVNLFLEKGKADINFNNGEPLKQACRMCDAELLKILLQHQPSVDTLNATFSV
ALTSQDTSARYKMCQRLLAAGANGEALDAGLVTAQQSSPADPRLIELLLSFGADINYNGG
AVIQRAIDNSDERQLSLLISRFPTTLTVTLGLERLLKIDTKKRNEMAKTLLDASQNRIPE
ALDSLLAEAILVNKGDITFLKMLIQYGASVNHQQGAAVINSIKGRRFDVFKLLLEQQASQ
GALEEAFKACWALKGADRLSYVSRILKGGYKGELMDSALLEVVQEMPCSHEAIKLLLKHG
ASVHYNRSHSLVHAAMAKDILTLGLLLEAVSDRAGVTYAFGKLISTDTSNWVTKEGYSTV
ELLLQNGASGEVLSLALIAAIETSDSNPRSSSFVELFLQHNANVDYQDGRAITASIAVGK
PHLTKAILKSSTSSQNINTGFLCIFNSDLTEDVAVELFDIFSKTDLDIQAMNGNIWSPRD
GNELREPITFQCLRKWPQGYKMLGRLLEAGIHVDALIPYVIDEEHGFEQVSLLSWVLLQP
QQLISPYVFECLLKNGADPNFQSTSSMMTPLLVASVDKSPDVIRKLIQHGAVVSVMDKHG
VTPLINASKRGQLTIMRCLIDAGAMVDDGSLHEASRELQSSAVQLLLDHGHSPNFPSMLH
EGRCALAELCFKAESPGTSLVKTRQTIDVLISGKADLAIQSQGKPLIYHAIDNPASCIST
TTALLASKMWRLINNDFNHYTCDGYVYSPSTYVSKCLAQSPSEYASELLRILKANGCKDV
FYKCEGPQPPDMVGAPAEVIAEEKRRKNRLQRMQEQEEDHQISLQRERDAADQQHQIMAR
THQLRTLHDRETADERDAAAERSNRLQLRLEAETAAQRQRFAAQQRLDDQEQLRMMNQLR
LEAAERQGRLQIENDKILANAQHNLLEAKMTVESRRIKELEAANERQYHRDSDLLSRQER
ILSDRKAFMVASPSASGVDESGLPTPEPRRQLTYTGSELD
Download sequence
Identical sequences A0A022Y5J5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]