SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022Y5L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022Y5L0
Domain Number 1 Region: 167-282
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000051
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022Y5L0
Sequence length 311
Comment (tr|A0A022Y5L0|A0A022Y5L0_TRISD) Uncharacterized protein {ECO:0000313|EMBL:EZF78200.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_00807 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MRQNTFVRENNWRDAETLLLRPLLDAERLLLWAVPYSQQSQIGSNSEEGPVKGTEYLNHY
SLLVVSLCECYRKALYCEEIEFSLGGITKILRQSSLSQQKQISLFGTNCWYNERNSANYR
DKEWFKRRSRYTLADAVHCYAKAFIRIARFQACYNPEPFEEKVINLQKALIDRDAISKPD
YLLENLLDRERIRGEYLGDTLLQETRKGNLEYTLFLLNEVSSLSDGLSGGETLVMAAQQG
WYPVVKSLIEHRASLEWKGETCRNAVSYAAENGDINSLNYLFWRREHFQMLRTHLGAVPY
FTLQVMDILTS
Download sequence
Identical sequences A0A022WEQ9 A0A022Y5L0 A0A080WPS6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]