SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023B104 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023B104
Domain Number 1 Region: 15-89
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.31e-26
Family Skp1 dimerisation domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023B104
Sequence length 92
Comment (tr|A0A023B104|A0A023B104_GRENI) Putative Skp1 family protein {ECO:0000313|EMBL:EZG45864.1} KW=Complete proteome; Reference proteome OX=110365 OS=Gregarina niphandrodes (Septate eugregarine). GN=GNI_136590 OC=Eugregarinorida; Gregarinidae; Gregarina.
Sequence
MPRPLPDRRFQDVVAEWDYKFTCVEIPTVFELILAANYLDIPGLADLCCARVASEIRGRS
VEEIRALFQIENDFTPEEEKQIREENRWCDPE
Download sequence
Identical sequences A0A023B104
XP_011132436.1.81794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]