SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023B263 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023B263
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.000000000173
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023B263
Sequence length 123
Comment (tr|A0A023B263|A0A023B263_GRENI) Signal recognition particle 14 kDa protein {ECO:0000313|EMBL:EZG48581.1} KW=Complete proteome; Reference proteome OX=110365 OS=Gregarina niphandrodes (Septate eugregarine). GN=GNI_128640 OC=Eugregarinorida; Gregarinidae; Gregarina.
Sequence
MGILNQDQFLEKVKSFVSNGHRPQNSIWLTVKSSVVGSKQYAMIRAKTSSKRYSTLVAKE
DVEKFIKGLSDLFVELEKHLRKIHVAKPGRKRVNQIRILRKSRQEMKDSDTEEDEEPASP
TDA
Download sequence
Identical sequences A0A023B263
XP_011132085.1.81794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]