SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023B2J9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023B2J9
Domain Number 1 Region: 31-188
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4e-16
Family Kanamycin nucleotidyltransferase (KNTase), N-terminal domain 0.063
Further Details:      
 
Domain Number 2 Region: 176-271
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000126
Family Poly(A) polymerase, PAP, middle domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023B2J9
Sequence length 294
Comment (tr|A0A023B2J9|A0A023B2J9_GRENI) Poly(A) polymerase central domain protein {ECO:0000313|EMBL:EZG54499.1} KW=Complete proteome; Reference proteome OX=110365 OS=Gregarina niphandrodes (Septate eugregarine). GN=GNI_120600 OC=Eugregarinorida; Gregarinidae; Gregarina.
Sequence
MDGRAAAAALTTAVQQLPDVFCHGLLEQLRATLDTFTLKVVTPTSAEREAKRELFNSFTE
FLRKAMQDRIAIAVAGSTAYEVDARNSDLDVVLLTSWGAPNYVLQSVVHYLSMTQALHNR
AANWPLKNVQLQLVDSARVPVLVVTTPSGLVCDVSVNTVNSIKHTEYFKRVLASTPTLRP
LLRLVKYWTKARKLPAAKEGGLPGIVWMILACTYGSCPAPIFLKAVHRPTNDGLSRTLSH
IDGTVPIFARLYRFFHLCSNRDLMSRTITSSDKLCFPKSKKHVAQRVASAANFC
Download sequence
Identical sequences A0A023B2J9
XP_011131841.1.81794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]