SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023BD01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023BD01
Domain Number 1 Region: 11-178
Classification Level Classification E-value
Superfamily eIF4e-like 1.7e-49
Family Translation initiation factor eIF4e 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023BD01
Sequence length 185
Comment (tr|A0A023BD01|A0A023BD01_GRENI) Eukaryotic translation initiation factor 4E type 2 {ECO:0000313|EMBL:EZG86780.1} KW=Complete proteome; Reference proteome OX=110365 OS=Gregarina niphandrodes (Septate eugregarine). GN=GNI_009130 OC=Eugregarinorida; Gregarinidae; Gregarina.
Sequence
MFFRRSEVEQLPMRLSLKLSCNWTLWYTNASAKTTETFEQCLIPLGSVSTAEAFWALYSH
CIRPSNLPKGTEYHLFREGIRPMWEDEANANGSTLLLRLKRGYIDYCWEALLLALIGGQL
GPEANGAVAGRRFTDDHLSLWSSKFHADQHQQISANVCRLLGLKEDSPSEYKSHAGTLER
TTVIP
Download sequence
Identical sequences A0A023BD01
XP_011128736.1.81794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]