SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023BD67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023BD67
Domain Number 1 Region: 311-362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 257-303
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  A0A023BD67
Domain Number - Region: 103-151
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00262
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023BD67
Sequence length 406
Comment (tr|A0A023BD67|A0A023BD67_GRENI) Thrombospondin type 1 domain protein {ECO:0000313|EMBL:EZG87454.1} KW=Complete proteome; Reference proteome OX=110365 OS=Gregarina niphandrodes (Septate eugregarine). GN=GNI_006920 OC=Eugregarinorida; Gregarinidae; Gregarina.
Sequence
MRWIIGPVLGPVWAELAGKPSMYGYLEEDALAPGSGGPFYDSLNLSAARAVAVADAAARG
VTSTASPRDETTTSGTMTETESTGTTSTTTTETETTWSSTSASCEYGAWGEWSGCPCDAE
KEYSNRTVVKVDPEAVCEADVRSRACEPNPCDPCTQGIGGDPALLACNRRTSTCSFEVGY
NEYNYRCRCFVGYQLMETAEALPTGCKDCCVDIDECADPVLNQCSDVCEDGLAQPQNYTC
SCQTGRYAVDARSCGSCQYSQWSAWTDCSVQCGTGETSRHKTPVDDSVAHPDVCQTITES
DQCTANDCNNPDDCHYTSWSDFGDCDQECGGGKQTRTRTLANGPDLCEPELFETMPCNTE
PCATSGYRISPKTVVLCALVVIFLLVLFSAVTWFWWTRQAPPGDLT
Download sequence
Identical sequences A0A023BD67
XP_011128659.1.81794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]