SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023BTU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023BTU7
Domain Number - Region: 12-43
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0889
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023BTU7
Sequence length 86
Comment (tr|A0A023BTU7|A0A023BTU7_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EZH73426.1} KW=Complete proteome; Reference proteome OX=1317122 OS=Aquimarina atlantica. GN=ATO12_15920 OC=Flavobacteriaceae; Aquimarina.
Sequence
MKLEDIKKEAAQYKYNDISSLSSKIREFKNKGVSFLGCVAFVQVNQEISLNEARELTVKL
DAYNEDEKKRIDAAYQLMLSEFKEEE
Download sequence
Identical sequences A0A023BTU7
WP_034242130.1.88905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]