SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023BXM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023BXM8
Domain Number 1 Region: 26-124
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.91e-22
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023BXM8
Sequence length 127
Comment (tr|A0A023BXM8|A0A023BXM8_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EZH74699.1} KW=Complete proteome; Reference proteome OX=1317122 OS=Aquimarina atlantica. GN=ATO12_13100 OC=Flavobacteriaceae; Aquimarina.
Sequence
MKKLSILVMCMTVGLVLANDPVKNLNAYKVAKTEIINVSPFCISIAKGDYEMVKKMVELG
SEVNKFSEGMTPLMYAARYNRLEIIKLLVANGAKINTKNAKGYTAIKYAELSGAKEAVTL
LLELKKK
Download sequence
Identical sequences A0A023BXM8
WP_034241310.1.88905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]